PDB entry 1b34

View 1b34 on RCSB PDB site
Description: crystal structure of the d1d2 sub-complex from the human snrnp core domain
Class: RNA binding protein
Keywords: snrnp, splicing, spliceosome, sm, core snrnp domain, systemic lupus erythematosus, sle, RNA binding protein
Deposited on 1998-12-17, released 2000-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.249
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (small nuclear ribonucleoprotein sm d1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b34a_
  • Chain 'B':
    Compound: protein (small nuclear ribonucleoprotein sm d2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b34b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b34A (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b34A (A:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b34B (B:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b34B (B:)
    tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemdryiskmflrgd
    svivvlrnpliagk