PDB entry 1b2z

View 1b2z on RCSB PDB site
Description: deletion of a buried salt bridge in barnase
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.17
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b2za_
  • Chain 'B':
    Domains in SCOP 1.55: d1b2zb_
  • Chain 'C':
    Domains in SCOP 1.55: d1b2zc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2zA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2zB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2zC (C:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrnsdrilyssnwliykttdhyqtftkir