PDB entry 1b2y

View 1b2y on RCSB PDB site
Description: structure of human pancreatic alpha-amylase in complex with the carbohydrate inhibitor acarbose
Class: hydrolase
Keywords: human alpha-amylase, acarbose, hydrolase
Deposited on 1998-12-03, released 2000-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-amylase)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b2ya1, d1b2ya2
  • Heterogens: G6D, GLC, AC1, BGC, CL, CA, PCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b2yA (A:)
    qyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b2yA (A:)
    yspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwer
    yqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfnp
    gsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskiae
    ymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlggep
    ikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhdn
    qrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgpp
    nnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafgr
    gnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsisn
    saedpfiaihaeskl