PDB entry 1b2x

View 1b2x on RCSB PDB site
Description: barnase wildtype structure at ph 7.5 from a cryo_cooled crystal at 100k
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b2xa_
  • Chain 'B':
    Domains in SCOP 1.55: d1b2xb_
  • Chain 'C':
    Domains in SCOP 1.55: d1b2xc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2xA (A:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2xB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2xC (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir