PDB entry 1b2w

View 1b2w on RCSB PDB site
Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody
Class: immune system
Keywords: antibody engineering, humanized and chimeric antibody, fab, x-ray structure, three-dimensional strycture, gamma-interferon
Deposited on 1998-12-01, released 1998-12-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.188
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (antibody (heavy chain))
    Domains in SCOP 1.75: d1b2wh1, d1b2wh2
  • Chain 'L':
    Compound: protein (antibody (light chain))
    Domains in SCOP 1.75: d1b2wl1, d1b2wl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2wH (H:)
    evqlvqsgggvvqpgrslklsclasgyiftsswinwvkqrpgrglewigridpsdgevhy
    nqdfkdrftisrdkskntlylqmnslrpedtavyycargflpwfadwgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2wL (L:)
    diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
    rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec