PDB entry 1b2v

View 1b2v on RCSB PDB site
Description: heme-binding protein a
Deposited on 1998-12-01, released 1999-06-24
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-24, with a file datestamp of 1999-06-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b2va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2vA (A:)
    afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
    nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
    slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata