PDB entry 1b2t

View 1b2t on RCSB PDB site
Description: solution structure of the cx3c chemokine domain of fractalkine
Class: chemokine
Keywords: chemokine
Deposited on 1998-12-01, released 1999-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (fractalkine)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P78423 (1-76)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1b2ta1, d1b2ta2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b2tA (A:)
  mqhhgvtkcnitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvk
  damqhldrqaaaltrng