PDB entry 1b2s

View 1b2s on RCSB PDB site
Description: structural response to mutation at a protein-protein interface
Deposited on 1998-11-30, released 1998-12-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b2sa_
  • Chain 'B':
    Domains in SCOP 1.55: d1b2sb_
  • Chain 'C':
    Domains in SCOP 1.55: d1b2sc_
  • Chain 'D':
    Domains in SCOP 1.55: d1b2sd_
  • Chain 'E':
    Domains in SCOP 1.55: d1b2se_
  • Chain 'F':
    Domains in SCOP 1.55: d1b2sf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2sA (A:)
    aqvintfdgvadylqtyhklpdnyitaseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2sB (B:)
    aqvintfdgvadylqtyhklpdnyitaseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2sC (C:)
    aqvintfdgvadylqtyhklpdnyitaseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2sD (D:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwdclagwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegcditiils
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2sE (E:)
    mkkavingeqirsisdlhqtlkkelalpeyygenldalwdclagwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegcditiils
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2sF (F:)
    kkavingeqirsisdlhqtlkkelalpeyygenldalwdclagwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegcditiils