PDB entry 1b2p

View 1b2p on RCSB PDB site
Description: native mannose-specific bulb lectin from scilla campanulata (bluebell) at 1.7 angstroms resolution
Class: sugar binding protein
Keywords: mannose-binding lectin, monocot, aglutinin, bluebell bulbs, protein- carbohydrate interactions, sugar binding protein
Deposited on 1998-11-30, released 1999-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lectin)
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZP49 (0-118)
      • conflict (26)
    Domains in SCOPe 2.08: d1b2pa_
  • Chain 'B':
    Compound: protein (lectin)
    Species: Hyacinthoides hispanica [TaxId:81759]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZP49 (0-118)
      • conflict (26)
    Domains in SCOPe 2.08: d1b2pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2pA (A:)
    nniifskqpddnhpqilhatesleilfgthvyrfimqtdcnlvlydnnnpiwatntgglg
    ngcravlqpdgvlvvitnenvtvwqspvagkaghyvlvlqpdrnvviygdalwatqtvr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2pB (B:)
    nniifskqpddnhpqilhatesleilfgthvyrfimqtdcnlvlydnnnpiwatntgglg
    ngcravlqpdgvlvvitnenvtvwqspvagkaghyvlvlqpdrnvviygdalwatqtvr