PDB entry 1b2p
View 1b2p on RCSB PDB site
Description: native mannose-specific bulb lectin from scilla campanulata (bluebell) at 1.7 angstroms resolution
Class: sugar binding protein
Keywords: mannose-binding lectin, monocot, aglutinin, bluebell bulbs, protein- carbohydrate interactions, sugar binding protein
Deposited on
1998-11-30, released
1999-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (lectin)
Species: Hyacinthoides hispanica [TaxId:81759]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1b2pa_ - Chain 'B':
Compound: protein (lectin)
Species: Hyacinthoides hispanica [TaxId:81759]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1b2pb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1b2pA (A:)
nniifskqpddnhpqilhatesleilfgthvyrfimqtdcnlvlydnnnpiwatntgglg
ngcravlqpdgvlvvitnenvtvwqspvagkaghyvlvlqpdrnvviygdalwatqtvr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1b2pB (B:)
nniifskqpddnhpqilhatesleilfgthvyrfimqtdcnlvlydnnnpiwatntgglg
ngcravlqpdgvlvvitnenvtvwqspvagkaghyvlvlqpdrnvviygdalwatqtvr