PDB entry 1b2n

View 1b2n on RCSB PDB site
Description: methanol dehydrogenase from methylophilus w3a1
Class: oxidoreductase
Keywords: oxidoreductase (pqq(a)-choh(d))
Deposited on 1998-11-27, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (methanol dehydrogenase heavy subunit)
    Species: Methylophilus methylotrophus
    Database cross-references and differences (RAF-indexed):
    • GB U41040 (0-570)
    Domains in SCOPe 2.07: d1b2na_
  • Chain 'B':
    Compound: protein (methanol dehydrogenase light subunit)
    Species: Methylophilus methylotrophus
    Database cross-references and differences (RAF-indexed):
    • GB U41041 (0-End)
    Domains in SCOPe 2.07: d1b2nb_
  • Chain 'C':
    Compound: protein (methanol dehydrogenase heavy subunit)
    Species: Methylophilus methylotrophus
    Database cross-references and differences (RAF-indexed):
    • GB U41040 (0-570)
    Domains in SCOPe 2.07: d1b2nc_
  • Chain 'D':
    Compound: protein (methanol dehydrogenase light subunit)
    Species: Methylophilus methylotrophus
    Database cross-references and differences (RAF-indexed):
    • GB U41041 (0-End)
    Domains in SCOPe 2.07: d1b2nd_
  • Heterogens: CA, PQQ, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2nA (A:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b2nB (B:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b2nB (B:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2nC (C:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b2nD (D:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b2nD (D:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian