PDB entry 1b2l

View 1b2l on RCSB PDB site
Description: alcohol dehydrogenase from drosophila lebanonensis: ternary complex with nad-cyclohexanone
Class: oxidoreductase
Keywords: oxidoreductase, detoxification, metabolism, alcohol dehydrogenase, drosophila lebanonensis, short-chain dehydrogenases/reductases, ternary complex, nad- cyclohexanone adduct
Deposited on 1998-11-26, released 1999-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alcohol dehydrogenase
  Species: Scaptodrosophila lebanonensis [TaxId:7225]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10807 (0-253)
  Domains in SCOPe 2.06: d1b2la_
• Heterogens: CA, NDC, CYH, DTT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b2lA (A:)
  mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
  tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
  fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
  pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
  leaiewtkhwdshi