PDB entry 1b2i

View 1b2i on RCSB PDB site
Description: kringle 2 domain of human plasminogen: nmr solution structure of trans-4-aminomethylcyclohexane-1-carboxylic acid (amcha) complex
Deposited on 1999-09-24, released 1999-11-19
The last revision prior to the SCOP 1.69 freeze date was dated 1999-11-19, with a file datestamp of 1999-11-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1b2ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2iA (A:)
    tseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdre
    lrpwcfttdpnkrwelcdiprct