PDB entry 1b2i

View 1b2i on RCSB PDB site
Description: kringle 2 domain of human plasminogen: nmr solution structure of trans-4-aminomethylcyclohexane-1-carboxylic acid (amcha) complex
Class: hydrolase
Keywords: serine protease, fibrinolysis, lysine-binding domain, plasminogen, kringle 2, hydrolase
Deposited on 1999-09-24, released 1999-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (plasminogen)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00747 (0-82)
    • engineered (0-1)
    • engineered (7)
  Domains in SCOPe 2.08: d1b2ia_
• Heterogens: AMH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b2iA (A:)
  tseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdre
  lrpwcfttdpnkrwelcdiprct