PDB entry 1b2h

View 1b2h on RCSB PDB site
Description: Oligo-Peptide Binding Protein Complexed with Lysyl-Ornithyl-Lysine
Class: peptide binding protein
Keywords: peptide binding protein
Deposited on 1998-11-11, released 1998-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic oligopeptide-binding protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b2ha_
  • Chain 'B':
    Compound: lys-orn-lys
    Database cross-references and differences (RAF-indexed):
    • PDB 1B2H (0-2)
  • Heterogens: ACT, U1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2hA (A:)
    advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
    aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
    iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
    qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
    idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
    iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
    fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
    neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
    pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh
    

  • Chain 'B':
    No sequence available.