PDB entry 1b2f

View 1b2f on RCSB PDB site
Description: ph affects glu b13 switching and sulfate binding in cubic insulin crystals (ph 6.98 coordinates)
Class: hormone/growth factor
Keywords: hormone, hormone/growth factor complex
Deposited on 1998-11-26, released 2003-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PROTEIN (INSULIN A chain)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.08: d1b2f.1
• Chain 'B':
  Compound: PROTEIN (INSULIN b chain)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.08: d1b2f.1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b2fA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b2fB (B:)
  fvnqhlcgshlvealylvcgergffytpka