PDB entry 1b2d

View 1b2d on RCSB PDB site
Description: ph affects glu b13 switching and sulfate binding in cubic insulin crystals (ph 6.35 coordinates)
Class: hormone/growth factor
Keywords: hormone, hormone/growth factor complex
Deposited on 1998-11-26, released 2003-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (INSULIN A chain)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b2d.1
  • Chain 'B':
    Compound: PROTEIN (INSULIN b chain)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b2d.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2dA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b2dB (B:)
    fvnqhlcgshlvealylvcgergffytpka