PDB entry 1b28

View 1b28 on RCSB PDB site
Description: arc repressor myl mutant from salmonella bacteriophage p22
Class: translation/regulation
Keywords: transcription regulation, hyperstable mutant, arc repressor, translation/regulation complex
Deposited on 1998-12-05, released 1999-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (regulatory protein arc)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Gene: MUTATED ARC GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03050
      • engineered (30)
      • engineered (35)
      • engineered (39)
    Domains in SCOPe 2.07: d1b28a_
  • Chain 'B':
    Compound: protein (regulatory protein arc)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Gene: MUTATED ARC GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03050 (0-52)
      • engineered (30)
      • engineered (35)
      • engineered (39)
    Domains in SCOPe 2.07: d1b28b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b28A (A:)
    mkgmskmpqfnlrwprevldlvrkvaeengmsvnsyiyqlvmesfkkegriga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b28B (B:)
    mkgmskmpqfnlrwprevldlvrkvaeengmsvnsyiyqlvmesfkkegriga