PDB entry 1b25

View 1b25 on RCSB PDB site
Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus
Class: oxidoreductase
Keywords: moco, tungstoenzyme, tungsten containing protein, hyperthermophile, oxidoreductase
Deposited on 1998-12-04, released 1999-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (formaldehyde ferredoxin oxidoreductase)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93738 (0-618)
    • PDB 1B25 (0-618)
    Domains in SCOPe 2.07: d1b25a1, d1b25a2
  • Chain 'B':
    Compound: protein (formaldehyde ferredoxin oxidoreductase)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93738 (0-618)
    • PDB 1B25 (0-618)
    Domains in SCOPe 2.07: d1b25b1, d1b25b2
  • Chain 'C':
    Compound: protein (formaldehyde ferredoxin oxidoreductase)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93738 (0-618)
    • PDB 1B25 (0-618)
    Domains in SCOPe 2.07: d1b25c1, d1b25c2
  • Chain 'D':
    Compound: protein (formaldehyde ferredoxin oxidoreductase)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O93738 (0-618)
    • PDB 1B25 (0-618)
    Domains in SCOPe 2.07: d1b25d1, d1b25d2
  • Heterogens: SF4, PTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b25A (A:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b25A (A:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b25B (B:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b25B (B:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b25C (C:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b25C (C:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b25D (D:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapiegekaekveykisydpikaqkvvelqrl
    rgglfemltacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvre
    fngkwdrkmdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketl
    keldldfvipelekvtnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b25D (D:)
    mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
    aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
    iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
    aagrpgmgavmgskklkavvirgtkeipvadkeelkklsqeayneilnspgypfwkrqgt
    maavewcntnyalptrnfsdgyfefarsidgytmegmkvqqrgcpycnmpcgnvvldaeg
    qeseldyenvallgsnlgigklnevsvlnriademgmdtislgvsiahvmeavergilke
    gptfgdfkgakqlaldiayrkgelgnlaaegvkamaeklgthdfamhvkglevsgyncyi
    ypamalaygtsaigahhkeawviaweigtapieykisydpikaqkvvelqrlrgglfeml
    tacrlpwvevglsldyypkllkaitgvtytwddlykaadrvysliraywvrefngkwdrk
    mdyppkrwfteglksgphkgehldekkydellseyyrirgwdergipkketlkeldldfv
    ipelekvtnle