PDB entry 1b24

View 1b24 on RCSB PDB site
Description: I-dmoi, intron-encoded endonuclease
Class: intron-encoded
Keywords: intron-encoded, endonuclease, homing, thermostable
Deposited on 1998-12-03, released 1999-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (I-dmoi)
    Species: Desulfurococcus mobilis [TaxId:2274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21505
      • (55)
      • (93)
      • (102)
    Domains in SCOPe 2.07: d1b24a1, d1b24a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b24A (A:)
    mhnnenvsgisayllgliigdgglyklkykgnrseyrvvitqksenlikqhiaplmqfli
    delnvkskiqivkgdtryelrvsskklyyyfanmlerirlfnmreqiafikglyvaegdk
    tlkrlriwnknkalleivsrwlnnlgvrntihlddhrhgvyvlnislrdrikfvhtilss
    hlnplppe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b24A (A:)
    vsgisayllgliigdgglyklkykgnrseyrvvitqksenlikqhiaplmqflidelnvk
    skiqivkgdtryelrvsskklyyyfanmlerirlfnmreqiafikglyvaegdktlkrlr
    iwnknkalleivsrwlnnlgvrntihlddhrhgvyvlnislrdrikfvhtils