PDB entry 1b21

View 1b21 on RCSB PDB site
Description: deletion of a buried salt bridge in barnase
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b21a_
  • Chain 'B':
    Domains in SCOP 1.55: d1b21b_
  • Chain 'C':
    Domains in SCOP 1.55: d1b21c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b21A (A:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b21B (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b21C (C:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir