PDB entry 1b21

View 1b21 on RCSB PDB site
Description: deletion of a buried salt bridge in barnase
Class: hydrolase
Keywords: microbial ribonuclease, alpha/beta protein, hydrolase
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (barnase)
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • engineered (68)
      • engineered (92)
    Domains in SCOPe 2.07: d1b21a_
  • Chain 'B':
    Compound: protein (barnase)
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • engineered (68)
      • engineered (92)
    Domains in SCOPe 2.07: d1b21b_
  • Chain 'C':
    Compound: protein (barnase)
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • engineered (68)
      • engineered (92)
    Domains in SCOPe 2.07: d1b21c_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b21A (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b21A (A:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b21B (B:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b21B (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b21C (C:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b21C (C:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgstwreadinytsgfrnsdrilyssnwliykttdhyqtftkir