PDB entry 1b1z

View 1b1z on RCSB PDB site
Description: streptococcal pyrogenic exotoxin a1
Deposited on 1998-11-24, released 1999-11-24
The last revision prior to the SCOP 1.63 freeze date was dated 1999-11-24, with a file datestamp of 1999-11-23.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1zA (A:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1zB (B:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1zC (C:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1zD (D:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt