PDB entry 1b1y

View 1b1y on RCSB PDB site
Description: sevenfold mutant of barley beta-amylase
Class: hydrolase
Keywords: hydrolase(o-glycosyl)
Deposited on 1998-11-25, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (beta-amylase)
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16098 (0-499)
      • conflict (0)
      • engineered (180)
      • engineered (290)
      • engineered (292)
      • engineered (345-347)
      • engineered (371)
      • conflict (470)
    Domains in SCOPe 2.07: d1b1ya_
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1yA (A:)
    mkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegkgpka
    ydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdifytdg
    hgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkdfldagvivdievglgpage
    lrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndagqyndtpertq
    ffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikiagvhwwykvp
    shaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqppdamsapeelvqqv
    lsagwreglnvscenalprydptayntilrnarphginqsgppehklfgftylrlsnqlv
    egqnyvnfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpkiqpfpfqeht
    dlpvgptggmggqaegptcg