PDB entry 1b1x

View 1b1x on RCSB PDB site
Description: structure of diferric mare lactoferrin at 2.62a resolution
Class: metal binding protein
Keywords: iron binding protein, lactoferrin, structure, antibacterial, metal binding protein
Deposited on 1998-11-24, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoferrin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77811 (0-688)
      • see remark 999 (222)
      • see remark 999 (268)
      • see remark 999 (289)
      • see remark 999 (293-295)
    Domains in SCOPe 2.07: d1b1xa1, d1b1xa2
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1xA (A:)
    aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld
    gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg
    rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk
    cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd
    afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf
    kdsalgfvripsqidsglylganyltatqnlretaaevaarrervvwcavgpeeerkckq
    wsdvsnrkvacasastteecialvlkgeadalnldggfiyvagkcglvpvlaenqksqns
    napdcvhrppegylavavvrksdadltwnslsgkkschtgvgrtaawnipmgllfnqtgs
    ckfdkffsqscapgadpqsslcalcvgnnenenkcmpnseeryygytgafrclaekagdv
    afvkdvtvlqntdgknsepwakdlkqedfellcldgtrkpvaeaeschlarapnhavvsq
    sdraqhlkkvlflqqdqfggngpdcpgkfclfksetknllfndnteclaelqgkttyeqy
    lgseyvtsitnlrrcsssplleacaflra