PDB entry 1b1w

View 1b1w on RCSB PDB site
Description: protein inhibitor of neuronal nitric oxide synthase/neuronal nitric oxide synthase
Deposited on 1998-11-24, released 2000-01-19
The last revision was dated 2000-02-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protein inhibitor of neuronal nitric oxide synthase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: protein (protein inhibitor of neuronal nitric oxide synthase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: protein (neuronal nitric oxide synthase)
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: protein (neuronal nitric oxide synthase)
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1b1wA (A:)
    mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
    nfgsyvthetkhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records):
    >1b1wA (A:)
    kaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnfgs
    yvthetkhfiyfylgqvaillfks
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1b1wB (B:)
    mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
    nfgsyvthetkhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records):
    >1b1wB (B:)
    kaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnfgs
    yvthetkhfiyfylgqvaillfks
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1b1wC (C:)
    kaemkdtgiqvdr
    

    Sequence, based on observed residues (ATOM records):
    >1b1wC (C:)
    emkdtgiqvdr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1b1wD (D:)
    kaemkdtgiqvdr
    

    Sequence, based on observed residues (ATOM records):
    >1b1wD (D:)
    emkdtgiqvdr