PDB entry 1b1j

View 1b1j on RCSB PDB site
Description: crystal structure of human angiogenin variant h13a.
Class: hydrolase
Keywords: hydrolase (vascularization), hydrolase
Deposited on 1998-11-20, released 1999-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrolase angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03950 (0-122)
      • see remark 999 (12)
    Domains in SCOPe 2.06: d1b1ja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1jA (A:)
    qdnsrythfltqaydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp