PDB entry 1b1i

View 1b1i on RCSB PDB site
Description: crystal structure of human angiogenin
Class: hydrolase
Keywords: hydrolase (vascularization), hydrolase
Deposited on 1998-11-20, released 1999-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hydrolase angiogenin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03950 (0-122)
  Domains in SCOPe 2.08: d1b1ia_
• Heterogens: CIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b1iA (A:)
  ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
  ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
  rrp