PDB entry 1b1g

View 1b1g on RCSB PDB site
Description: solvated refinement of ca-loaded calbindin d9k
Deposited on 1998-11-20, released 1998-11-25
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1b1ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b1gA (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
  vsfeefqvlvkkisq