PDB entry 1b1g

View 1b1g on RCSB PDB site
Description: solvated refinement of ca-loaded calbindin d9k
Class: metal binding protein
Keywords: calcium-binding protein, metal binding protein
Deposited on 1998-11-20, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (calbindin d9k)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02633 (0-74)
  Domains in SCOPe 2.08: d1b1ga_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b1gA (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
  vsfeefqvlvkkisq