PDB entry 1b1e

View 1b1e on RCSB PDB site
Description: crystal structure of human angiogenin variant k40q
Class: hydrolase
Keywords: hydrolase (vascurisation), hydrolase
Deposited on 1998-11-20, released 1999-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hydrolase angiogenin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03950 (0-122)
    • see remark 999 (39)
  Domains in SCOPe 2.08: d1b1ea_
• Heterogens: CIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b1eA (A:)
  qdnsrythfltqhydakpqgrddrycesimrrrgltspcqdintfihgnkrsikaicenk
  ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
  rrp