PDB entry 1b1c

View 1b1c on RCSB PDB site
Description: crystal structure of the fmn-binding domain of human cytochrome p450 reductase at 1.93a resolution
Class: oxidoreductase
Keywords: flavoprotein, cytochrome p450 reductase, p450 reductase, fmn-binding domain, fmn, oxidoreductase
Deposited on 1998-11-19, released 1999-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nadph-cytochrome p450 reductase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b1ca_
  • Heterogens: CA, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b1cA (A:)
    tssvressfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydla
    dlsslpeidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyeh
    fnamgkyvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgveatgees
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b1cA (A:)
    ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
    eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
    yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfg