PDB entry 1b1b

View 1b1b on RCSB PDB site
Description: iron dependent regulator
Class: metal binding protein
Keywords: ider, iron depedent regulator, mycobacterium tuberculosis, metal binding protein
Deposited on 1998-11-19, released 1999-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.28
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (iron dependent regulator)
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b1ba1, d1b1ba2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1bA (A:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipglvelgv