PDB entry 1b1a

View 1b1a on RCSB PDB site
Description: glutamate mutase (b12-binding subunit), nmr, minimized average structure
Deposited on 1998-11-19, released 1999-07-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-07-13, with a file datestamp of 1999-07-12.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1b1a__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b1a_ (-)
    mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqevfikaaietkadaill
    sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
    tppevgiadlkkdlnie