PDB entry 1b16

View 1b16 on RCSB PDB site
Description: alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-3-pentanone
Class: oxidoreductase
Keywords: oxidoreductase, detoxification, metabolism, alcohol dehydrogenase, drosophila lebanonensis, short-chain dehydrogenases/reductases, ternary complex, nad-3- pentanone adduct
Deposited on 1998-11-25, released 1999-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.184
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alcohol dehydrogenase)
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b16a_
  • Chain 'B':
    Compound: protein (alcohol dehydrogenase)
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b16b_
  • Heterogens: NAQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b16A (A:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b16B (B:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi