PDB entry 1b15

View 1b15 on RCSB PDB site
Description: alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone
Class: oxidoreductase
Keywords: oxidoreductase, detoxification, metabolism, alcohol dehydrogenase, drosophila lebanonensis, short-chain dehydrogenases/reductases, ternary complex, nad- acetone adduct
Deposited on 1998-11-25, released 1999-11-26
The last revision prior to the SCOP 1.73 freeze date was dated 1999-11-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Drosophila lebanonensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1b15a_
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Drosophila lebanonensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1b15b_
  • Heterogens: NAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b15A (A:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b15B (B:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi