PDB entry 1b13

View 1b13 on RCSB PDB site
Description: clostridium pasteurianum rubredoxin g10a mutant
Class: electron transport
Keywords: electron transport, metalloprotein, iron sulfur, electron transfer
Deposited on 1998-11-26, released 1999-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.171
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (rubredoxin)
  Species: Clostridium pasteurianum [TaxId:1501]
  Gene: CLORUB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00268 (0-53)
    • engineered (9)
  Domains in SCOPe 2.08: d1b13a_
• Heterogens: FE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b13A (A:)
  mkkytctvcayiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeevee