PDB entry 1b11

View 1b11 on RCSB PDB site
Description: structure of feline immunodeficiency virus protease complexed with tl-3-093
Deposited on 1998-11-25, released 1998-12-02
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-01, with a file datestamp of 2002-02-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1791
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1b11a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b11A (A:)
  vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
  rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm