PDB entry 1b11

View 1b11 on RCSB PDB site
Description: structure of feline immunodeficiency virus protease complexed with tl-3-093
Deposited on 1998-11-25, released 1998-12-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1791
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b11a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b11A (A:)
    vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
    rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm