PDB entry 1b11

View 1b11 on RCSB PDB site
Description: structure of feline immunodeficiency virus protease complexed with tl-3-093
Class: hydrolase/hydrolase inhibitor
Keywords: fiv protease, hydrolase-hydrolase inhibitor complex
Deposited on 1998-11-25, released 1998-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PROTEIN (Feline Immunodeficiency Virus PROTEASE)
  Species: Feline immunodeficiency virus [TaxId:11673]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16088 (0-112)
  Domains in SCOPe 2.08: d1b11a_
• Heterogens: SO4, 3TL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b11A (A:)
  vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
  rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm