PDB entry 1b10

View 1b10 on RCSB PDB site
Description: solution nmr structure of recombinant syrian hamster prion protein rprp(90-231) , 25 structures
Class: prion protein
Keywords: prion, scrapie, brain, glycoprotein, prion protein
Deposited on 1998-11-25, released 1998-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (prion protein)
    Species: Mesocricetus auratus [TaxId:10036]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b10a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1b10A (A:)
gqgggthnqwnkpskpktnmkhmagaaaagavvgglggymlgsamsrpmmhfgndwedry
yrenmnrypnqvyyrpvdqynnqnnfvhdcvnitikqhtvttttkgenftetdikimerv
veqmcttqyqkesqayydgrrs

    Sequence, based on observed residues (ATOM records): (download) 
    >1b10A (A:)
lggymlgsamsrpmmhfgndwedryyrenmnrypnqvyyrpvdqynnqnnfvhdcvniti
kqhtvttttkgenftetdikimervveqmcttqyqkesqayydg