PDB entry 1b0z

View 1b0z on RCSB PDB site
Description: The crystal structure of phosphoglucose isomerase-an enzyme with autocrine motility factor activity in tumor cells
Class: isomerase
Keywords: phosphoglucose isomerase, autocrinefactor, neuroleukin, crystallography motility, isomerase
Deposited on 1998-11-15, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphoglucose isomerase)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: PGIB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b0za_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0zA (A:)
    maisfdysnalpfmqeneldylsefvkaahhmlherkgpgsdflgwvdwpirydknefsr
    ikqaaerirnhsdalvvigiggsylgaraaiealshtfhnqmndttqiyfagqnisstyi
    shlldvlegkdlsinvisksgtttepaiafrifrdymekkygkeearkriyvttdrtkga
    lkkladqegyetfvipdniggrysvltavgllpiavaglnidrmmegaasayhkynnpdl
    ltnesyqyaavrnilyrkgkaiellvnyepslhyvsewwkqlfgesegkdqkglfpasvd
    fttdlhsmgqyvqegrrnlietvlhvkkpqieltiqedpenidglnflagktldevnkka
    fqgtllahvdggvpnliveldemneytfgemvyffekacgisghllgvnpfdqpgveayk
    knmfallgkpgfedekaalmkrlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0zA (A:)
    aisfdysnalpfmqeneldylsefvkaahhmlherkgpgsdflgwvdwpirydknefsri
    kqaaerirnhsdalvvigiggsylgaraaiealshtfhnqmndttqiyfagqnisstyis
    hlldvlegkdlsinvisksgtttepaiafrifrdymekkygkeearkriyvttdrtkgal
    kkladqegyetfvipdniggrysvltavgllpiavaglnidrmmegaasayhkynnpdll
    tnesyqyaavrnilyrkgkaiellvnyepslhyvsewwkqlfgesegkdqkglfpasvdf
    ttdlhsmgqyvqegrrnlietvlhvkkpqieltiqedpenidglnflagktldevnkkaf
    qgtllahvdggvpnliveldemneytfgemvyffekacgisghllgvnpfdqpgveaykk
    nmfallgkpgfedekaalmkrl