PDB entry 1b0y

View 1b0y on RCSB PDB site
Description: mutant h42q of hipip from chromatium vinosum at 0.93a
Deposited on 1998-11-15, released 1998-12-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-31, with a file datestamp of 2000-03-31.
Experiment type: XRAY
Resolution: 0.93 Å
R-factor: 0.1545
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1b0ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b0yA (A:)
  sapanavaadnataialkynqdatkservaaarpglppeeqqcancqfmqadaagatdew
  kgcqlfpgklinvngwcaswtlkag