PDB entry 1b0y

View 1b0y on RCSB PDB site
Description: mutant h42q of hipip from chromatium vinosum at 0.93a
Class: electron transport
Keywords: electron transfer protein, atomic resolution, direct methods iron-sulphur cluster, metalloprotein, electron transport
Deposited on 1998-11-15, released 1998-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 0.93 Å
R-factor: N/A
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hipip)
    Species: Allochromatium vinosum [TaxId:1049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00260 (0-84)
      • engineered (41)
    Domains in SCOPe 2.08: d1b0ya_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0yA (A:)
    sapanavaadnataialkynqdatkservaaarpglppeeqqcancqfmqadaagatdew
    kgcqlfpgklinvngwcaswtlkag