PDB entry 1b0x

View 1b0x on RCSB PDB site
Description: the crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
Class: transferase
Keywords: receptor tyrosine kinase, protein interaction module, dimerization domain
Deposited on 1998-11-14, released 1999-05-03
The last revision prior to the SCOP 1.75 freeze date was dated 1999-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (epha4 receptor tyrosine kinase)
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03137 (Start-93)
  Domains in SCOP 1.75: d1b0xa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1b0xA (A:)
  gsrtgsessrpntalldpsspefsavvsvgdwlqaikmdrykdnftaagyttleavvhms
  qddlarigitaithqnkilssvqamrtqmqqmhg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1b0xA (A:)
  fsavvsvgdwlqaikmdrykdnftaagyttleavvhmsqddlarigitaithqnkilssv
  qamrtqmqqmhg