PDB entry 1b0x

View 1b0x on RCSB PDB site
Description: the crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
Class: transferase
Keywords: receptor tyrosine kinase, protein interaction module, dimerization domain, transferase
Deposited on 1998-11-14, released 1999-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (epha4 receptor tyrosine kinase)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b0xa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0xA (A:)
    gsrtgsessrpntalldpsspefsavvsvgdwlqaikmdrykdnftaagyttleavvhms
    qddlarigitaithqnkilssvqamrtqmqqmhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0xA (A:)
    fsavvsvgdwlqaikmdrykdnftaagyttleavvhmsqddlarigitaithqnkilssv
    qamrtqmqqmhg