PDB entry 1b0w

View 1b0w on RCSB PDB site
Description: Structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts
Class: immune system
Keywords: immunoglobulin, amyloid, immune system
Deposited on 1998-11-13, released 1998-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b0wa_
  • Chain 'B':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b0wb_
  • Chain 'C':
    Compound: bence-jones kappa I protein bre
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b0wc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0wA (A:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0wB (B:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0wC (C:)
    diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
    rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr