PDB entry 1b0v

View 1b0v on RCSB PDB site
Description: i40n mutant of azotobacter vinelandii fdi
Class: electron transport
Keywords: iron-sulfur, electron transport
Deposited on 1998-11-12, released 2000-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin)
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214
      • engineered (39)
    Domains in SCOPe 2.08: d1b0va_
  • Chain 'B':
    Compound: protein (ferredoxin)
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214
      • engineered (39)
    Domains in SCOPe 2.08: d1b0vb_
  • Chain 'C':
    Compound: protein (ferredoxin)
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214
      • engineered (39)
    Domains in SCOPe 2.08: d1b0vc_
  • Chain 'D':
    Compound: protein (ferredoxin)
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • engineered (39)
    Domains in SCOPe 2.08: d1b0vd_
  • Heterogens: SF4, F3S

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0vA (A:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecndcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0vB (B:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecndcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0vC (C:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecndcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0vD (D:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecndcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler