PDB entry 1b0u

View 1b0u on RCSB PDB site
Description: ATP-binding subunit of the histidine permease from salmonella typhimurium
Class: transport protein
Keywords: abc transporter, histidine permease, transport protein
Deposited on 1998-11-12, released 1999-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine permease
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02915 (Start-257)
      • expression tag (258-261)
    Domains in SCOPe 2.07: d1b0ua1, d1b0ua2
  • Heterogens: CL, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0uA (A:)
    mmsenklhvidlhkrygghevlkgvslqaragdvisiigssgsgkstflrcinflekpse
    gaiivngqninlvrdkdgqlkvadknqlrllrtrltmvfqhfnlwshmtvlenvmeapiq
    vlglskhdareralkylakvgideraqgkypvhlsggqqqrvsiaralamepdvllfdep
    tsaldpelvgevlrimqqlaeegktmvvvthemgfarhvsshviflhqgkieeegdpeqv
    fgnpqsprlqqflkgslkkleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0uA (A:)
    nklhvidlhkrygghevlkgvslqaragdvisiigssgsgkstflrcinflekpsegaii
    vngqninlvrdkdgqlkvadknqlrllrtrltmvfqhfnlwshmtvlenvmeapiqvlgl
    skhdareralkylakvgideraqgkypvhlsggqqqrvsiaralamepdvllfdeptsal
    dpelvgevlrimqqlaeegktmvvvthemgfarhvsshviflhqgkieeegdpeqvfgnp
    qsprlqqflkgslkkleh