PDB entry 1b0t

View 1b0t on RCSB PDB site
Description: d15k/k84d mutant of azotobacter vinelandii fdi
Deposited on 1998-11-12, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b0ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b0tA (A:)
afvvtdncikckytkcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitedkdplpdaedwdgvkgklqhler