PDB entry 1b0t

View 1b0t on RCSB PDB site
Description: d15k/k84d mutant of azotobacter vinelandii fdi
Class: electron transport
Keywords: electron transport, iron-sulfur
Deposited on 1998-11-12, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ferredoxin I)
  Species: Azotobacter vinelandii [TaxId:354]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00214 (0-105)
    • engineered (14)
    • engineered (83)
  Domains in SCOPe 2.08: d1b0ta_
• Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b0tA (A:)
  afvvtdncikckytkcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitedkdplpdaedwdgvkgklqhler