PDB entry 1b0t

View 1b0t on RCSB PDB site
Description: d15k/k84d mutant of azotobacter vinelandii fdi
Class: electron transport
Keywords: electron transport, iron-sulfur
Deposited on 1998-11-12, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin I)
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • engineered (14)
      • engineered (83)
    Domains in SCOPe 2.07: d1b0ta_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0tA (A:)
    afvvtdncikckytkcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitedkdplpdaedwdgvkgklqhler